PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010934839.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MYB
Protein Properties Length: 327aa    MW: 36773.9 Da    PI: 10.3093
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010934839.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.51.8e-195197148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT  Ed+llv+avkq+ g++Wk+Ia+ ++ gR++ qc +rwqk+l
   XP_010934839.1 51 KGGWTDKEDDLLVKAVKQFNGKNWKKIAELFP-GRSDVQCLHRWQKVL 97
                     688*****************************.************986 PP

2Myb_DNA-binding621.2e-19103149148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd++++++v+++G + W+ Ia+ ++ gR +kqc++rw+++l
   XP_010934839.1 103 KGTWTKEEDDRIIKLVAKHGCKKWSVIAKSLP-GRIGKQCRERWHNHL 149
                      799*****************************.*************97 PP

3Myb_DNA-binding58.51.5e-18155197145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eE+  l++a++ +G++ W+ Ia+ ++ gRt++++k++w+
   XP_010934839.1 155 KDAWTPEEEVTLIHAHQIYGNK-WAEIAKLLP-GRTDNSIKNHWN 197
                      689*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.284697IPR017930Myb domain
SuperFamilySSF466894.52E-1649103IPR009057Homeodomain-like
SMARTSM007173.2E-165099IPR001005SANT/Myb domain
PfamPF002499.7E-175197IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-2253109IPR009057Homeodomain-like
CDDcd001674.07E-145497No hitNo description
PROSITE profilePS5129431.26698153IPR017930Myb domain
SuperFamilySSF466892.79E-32100196IPR009057Homeodomain-like
SMARTSM007177.3E-17102151IPR001005SANT/Myb domain
PfamPF002499.9E-19103149IPR001005SANT/Myb domain
CDDcd001676.01E-16105149No hitNo description
Gene3DG3DSA:1.10.10.602.2E-27110156IPR009057Homeodomain-like
SMARTSM007171.7E-17154202IPR001005SANT/Myb domain
PROSITE profilePS5129421.803154204IPR017930Myb domain
PfamPF002495.8E-17155197IPR001005SANT/Myb domain
CDDcd001673.32E-13157197No hitNo description
Gene3DG3DSA:1.10.10.602.4E-24157204IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MVEEVKMEDG KNDRIQEISL PSCSPDSDGS CEMTPGTISG RTSGPTRRST KGGWTDKEDD  60
LLVKAVKQFN GKNWKKIAEL FPGRSDVQCL HRWQKVLNPE LVKGTWTKEE DDRIIKLVAK  120
HGCKKWSVIA KSLPGRIGKQ CRERWHNHLN PSIKKDAWTP EEEVTLIHAH QIYGNKWAEI  180
AKLLPGRTDN SIKNHWNCSV KKKLGSCLAS GIPSQPFGNP AFKLNSHQET VGSLKSHPAK  240
LGEVKSKTES YVKQTQSPVQ YCTPPVISPS HTFSPRDPIS YLRAAAKSFK DTPSIFRRRR  300
LLDLSRTHIL NGKHFSQSSN DSFGTRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C1e-69512046159MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-69512046159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1295300FRRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010934839.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
RefseqXP_010934840.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
SwissprotQ9S7G77e-91MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLM0S4X91e-101M0S4X9_MUSAM; Uncharacterized protein
STRINGMLOC_10556.16e-94(Hordeum vulgare)
STRINGGSMUA_Achr2P03880_0011e-100(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.28e-93myb domain protein 3r-5